| Transcript | Ll_transcript_191951 |
|---|---|
| CDS coordinates | 13-315 (+) |
| Peptide sequence | MFSGFHPTHFMMDASNFAIILITNGDFLLKGGVGCSISCRCEGCKNAFGRKDGKFPLTLQNGSGSQSIFNILFVSRGDNISLVTWFSCQFLLFLVQVLLL* |
| ORF Type | complete |
| Blastp | Protein tesmin/TSO1-like CXC 3 from Arabidopsis with 84.62% of identity |
|---|---|
| Blastx | Protein tesmin/TSO1-like CXC 2 from Arabidopsis with 48.65% of identity |
| Eggnog | Tesmin TSO1-like CXC domain containing protein(ENOG4110UR5) |
| Kegg | Link to kegg annotations (AT3G22760) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422104.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer