Protein coding transcript 203356

• Transcript: Ll_transcript_191972
• CDS coordinates: 3-707 (+)
• Peptide sequence: LTQVSNLLFLFHLSASSIPFIHFLTSVVNDMAVQDSDSEIEKYDLLDPSLPGKVVGNISISCSVEDPIEIEKGFVRRILSIVDYNEDGMLSLSEFSDLIDAFGNQVATDKREELFKAADKNGDGVVSMDELASLLAFQQEKESLLNCCPVCGEVLQISDQISDMIHLTLCFDEGTGNQVMTGGFLTDKQASYGWFFKLSEWAHFTSYDVGLRSGSSASHILDVQTEFAQSHAPQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_191972

• Blastp: Phosphatidylserine decarboxylase proenzyme 2 from Oryza sativa with 70.31% of identity
• Blastx: Phosphatidylserine decarboxylase proenzyme 2 from Oryza sativa with 61.85% of identity
• Eggnog: Phosphatidylserine decarboxylase(COG0688)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419975.1)
• Pfam: EF hand (PF13202.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;