Protein coding transcript 203372

• Transcript: Ll_transcript_191959
• CDS coordinates: 693-1520 (+)
• Peptide sequence: MLSLSEFSDLIDAFGNQVATDKREELFKAADKNGDGVVSMDELASLLAFQQEKESLLNCCPVCGEVLQISDQISDMIHLTLCFDEGTGNQVMTGGFLTDKQASYGWFFKLSEWAHFTSYDVGLRSGSSASHILVYDRKTQRLVEEIIDKKIVLSMRAIYQSKIGLGLMDIGVKELLQSISEKQGARMDSPESSADIPKFIESYKGQINLAEVKHPLERFKTFNEFFIRELKPGSRPVASAECDDIAVCAADCRLMAFTSVDDSSRFWIKGRKFSIQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_191959

• Blastp: Phosphatidylserine decarboxylase proenzyme 2 from Arabidopsis with 73.45% of identity
• Blastx: Phosphatidylserine decarboxylase proenzyme 2 from Arabidopsis with 60.52% of identity
• Eggnog: Phosphatidylserine decarboxylase(COG0688)
• Kegg: Link to kegg annotations (AT5G57190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419975.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;