Transcript | Ll_transcript_191996 |
---|---|
CDS coordinates | 702-1379 (+) |
Peptide sequence | MLSLSEFSDLIDAFGNQVATDKREELFKAADKNGDGVVSMDELASLLAFQQEKESLLNCCPVCGEVLQISDQISDMIHLTLCFDEGTGNQVMTGGFLTDKQASYGWFFKLSEWAHFTSYDVGLRSGSSASHILVYDRKTQRLVEEIIDKKIVLSMRAIYQSKIGLGLMDIGVKELLQSISEKQGARMDSPESSADIPKFIESYKGQINLAEVKHPLERFKVGCDF* |
ORF Type | complete |
Blastp | Phosphatidylserine decarboxylase proenzyme 2 from Oryza sativa with 73.66% of identity |
---|---|
Blastx | Phosphatidylserine decarboxylase proenzyme 2 from Arabidopsis with 58.31% of identity |
Eggnog | Phosphatidylserine decarboxylase(COG0688) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419975.1) |
Pfam | EF-hand domain pair (PF13833.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer