Protein coding transcript 203382

• Transcript: Ll_transcript_191960
• CDS coordinates: 3-410 (+)
• Peptide sequence: KIKDKNKGSSSSSSSPSSSPSSSSSRRARLKESMRRHLHRSNKGPSSSSSSSSSSLSNNIQFAGIALFTFLHAEMQFKDKWIACLSFGEQTFRTFTSHHTDQPLWNSVTTTLSFLLLYLCIYLFTASFIHLLFLP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_191960

• Blastp: Phosphatidylserine decarboxylase proenzyme 3 from Arabidopsis with 45.26% of identity
• Blastx: Phosphatidylserine decarboxylase proenzyme 3 from Arabidopsis with 38.85% of identity
• Eggnog: Phosphatidylserine decarboxylase(COG0688)
• Kegg: Link to kegg annotations (AT4G25970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419975.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;