Protein coding transcript 203388

• Transcript: Ll_transcript_192006
• CDS coordinates: 699-1376 (+)
• Peptide sequence: MLSLSEFSDLIDAFGNQVATDKREELFKAADKNGDGVVSMDELASLLAFQQEKESLLNCCPVCGEVLQISDQISDMIHLTLCFDEGTGNQVMTGGFLTDKQASYGWFFKLSEWAHFTSYDVGLRSGSSASHILVYDRKTQRLVEEIIDKKIVLSMRAIYQSKIGLGLMDIGVKELLQSISEKQGARMDSPESSADIPKFIESYKGQINLAEVKHPLERFKVGCDF*
• ORF Type: complete

Annotations of Ll_transcript_192006

• Blastp: Phosphatidylserine decarboxylase proenzyme 2 from Oryza sativa with 73.66% of identity
• Blastx: Phosphatidylserine decarboxylase proenzyme 2 from Arabidopsis with 58.45% of identity
• Eggnog: Phosphatidylserine decarboxylase(COG0688)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419975.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;