Protein coding transcript 203469

• Transcript: Ll_transcript_192985
• CDS coordinates: 1-996 (+)
• Peptide sequence: LEMTTTSLFRLSFLLLFISHAFSDLCNPQDKKVLLQIKKDLNNPYLLASWDPNTDCCDWYTINCDPKTHRINSLTIFSSTPDTNFSAQIPPSVGLLPYLETLEFHKLPKLTGPLPPAITKLKHLKFLRISWTNLSGPVPAFLSGLTNLTFLDLSFNNLTGSIPGSLGNLENLDAIHLDRNHLTGSIPPSFGSFKSNPDIYLSHNNLTGTIPTSFKNLKSNVIDLSRNKLVGDASPVFGSALQRVDLSRNQFSFDLSKVEFASSLTSLDLNHNKIYGNIPQVLTTLDLQFLNVSYNRLCGQIPVGGKLQNFDVYEYFHNKCLCGSPLPSCKN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_192985

• Blastp: Polygalacturonase inhibitor from Pyrus with 68.71% of identity
• Blastx: Polygalacturonase inhibitor from Pyrus with 69.97% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419773.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;