Transcript | Ll_transcript_193415 |
---|---|
CDS coordinates | 675-1214 (+) |
Peptide sequence | MSEPLTSLVEAVRRNKSSNKSPMKEIAVTPVPVDSSDSDSEVPKFQVKKHSHTGGKRDSNSTKLRRLQDTQERTVKFYGDLNLPAPAPVIGSSTESNNKFGNLSAQPVIGSSGKIFGGPVWFSLVASEDKEEGARLPQISSCFIRVKDGSLPVSYIEKYIAKKLDLPSDAQVNWFTLFC* |
ORF Type | complete |
Blastp | E3 ubiquitin protein ligase DRIP1 from Arabidopsis with 36.29% of identity |
---|---|
Blastx | E3 ubiquitin protein ligase DRIP2 from Arabidopsis with 30.93% of identity |
Eggnog | Polycomb group ring finger(ENOG410XPCN) |
Kegg | Link to kegg annotations (AT1G06770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452165.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer