Protein coding transcript 2037

• Transcript: Ll_transcript_325229
• CDS coordinates: 58-828 (+)
• Peptide sequence: MIICNSITFNYNPCFSFTNFYPSSLPLSLQIKPSKSLSLIVSARKKNNTDDSHSSVPKPDESTGFFPEAVLLKKRTVEEDGKALPEFEDDEERQLFESLMLDVETDMNVELMRHYEVMYLIHEKHVEEVAAVNEKIQDFLREKKGRVWRLNDWGIRKLAYKIQKAKSAHYMLMNFELEAKSINDFKTLLDKDERVIRHLVIKRDEAITEDCLPPPLFSGSADDSDDEDYEDWDDEDEMDDSDDEDYEDWDDEDEMDD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_325229

• Blastp: 30S ribosomal protein S6 from Alcanivorax with 42.86% of identity
• Blastx: 30S ribosomal protein S6 from Alcanivorax with 42.86% of identity
• Eggnog: Binds together with S18 to 16S ribosomal RNA (By similarity)(COG0360)
• Kegg: Link to kegg annotations (ABO_2191)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419062.1)
• Pfam: Ribosomal protein S6 (PF01250.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;