Protein coding transcript 203702

• Transcript: Ll_transcript_191505
• CDS coordinates: 103-744 (+)
• Peptide sequence: MEHCIFSNLKTQPLWLLFLFSLGSITLLRFSFIFLNWVYVNFLRPSKNLKKYGSWALITGPTDGIGKGFAFHLARKGLNLVLVGRSPEKLKDVSDSIAAKFGKIKVVTVVVDFSGDLDSGMEKIREAIEGLDVGVLVNNVGVSYPYARFFHEVDDEILRNLIKVNIEGTTKVTQVVLPGMIKRKKGAIVNLGSGAAIVIPSDPLYAVYAASKA*
• ORF Type: complete

Annotations of Ll_transcript_191505

• Blastp: Very-long-chain 3-oxoacyl-CoA reductase 1 from Arabidopsis with 65.26% of identity
• Blastx: Very-long-chain 3-oxoacyl-CoA reductase 1 from Arabidopsis with 65.57% of identity
• Eggnog: Dehydrogenase(COG0300)
• Kegg: Link to kegg annotations (AT1G67730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414745.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;