Protein coding transcript 20372

• Transcript: Ll_transcript_282932
• CDS coordinates: 685-1146 (+)
• Peptide sequence: MPQSSDYNEMVPTEVGRVEVFPPAKVSSYGGGSTAGNISQWSFDELLGLDEFIQNYNYMEGSSKADSGKHEDSDSPVLRSIEEGMKESDDYLGHVPDSSWKVPQIPSPPTASGLQWPKVLQYSSDSAMFVPDISFSHNMQQHHNSSSRRRRHP*
• ORF Type: complete

Annotations of Ll_transcript_282932

• Blastp: B-box zinc finger protein 22 from Arabidopsis with 43.61% of identity
• Blastx: B-box zinc finger protein 22 from Arabidopsis with 45.13% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT1G78600)
• CantataDB: Link to cantataDB annotations (CNT0000728)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424628.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;