Protein coding transcript 20373

• Transcript: Ll_transcript_282934
• CDS coordinates: 236-604 (+)
• Peptide sequence: MKIQCNVCEVAEAKVLCCADEAALCWECDEKVHAANKLASKHQRVSLSMSSSHMPKCDICQEAFGYFFCLEDRALLCRKCDLAIHTANAYVSGHQRFLLTGVRVGLEATDPGLGASSSSLKSD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_282934

• Blastp: B-box zinc finger protein 22 from Arabidopsis with 74.8% of identity
• Blastx: B-box zinc finger protein 22 from Arabidopsis with 74.8% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT1G78600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456927.1)
• Pfam: B-box zinc finger (PF00643.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;