Protein coding transcript 203759

• Transcript: Ll_transcript_191126
• CDS coordinates: 36-401 (+)
• Peptide sequence: MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRTYGGVLSGGAVRERIVRAFLVEEQKIVKKVLKIQKAKEKKASKKA*
• ORF Type: complete

Annotations of Ll_transcript_191126

• Blastp: 60S ribosomal protein L34 from Pisum with 93.28% of identity
• Blastx: 60S ribosomal protein L34 from Pisum with 94.74% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422247.1)
• Pfam: Ribosomal protein L34e (PF01199.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;