| Transcript | Ll_transcript_191141 |
|---|---|
| CDS coordinates | 1-321 (+) |
| Peptide sequence | TKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLSRNRRTVNRAYGGVLSGGAVRERIIRAFLVEEQKIVKKVLKIQKAKEKQASKA* |
| ORF Type | 5prime_partial |
| Blastp | 60S ribosomal protein L34 from Pisum with 97.14% of identity |
|---|---|
| Blastx | 60S ribosomal protein L34 from Pisum with 98.77% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428122.1) |
| Pfam | Ribosomal protein L34e (PF01199.17) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer