Protein coding transcript 2038

• Transcript: Ll_transcript_325230
• CDS coordinates: 647-1126 (+)
• Peptide sequence: MYLIHEKHVEEVAAVNEKIQDFLREKKGRVWRLNDWGIRKLAYKIQKAKSAHYMLMNFELEAKSINDFKTLLDKDERVIRHLVIKRDEAITEDCLPPPLFSGSADDSDDEDYEDWDDEDEMDDYDDEEEDGIIVIDGDDDDTDSRDDTSAYVKQPERTK*
• ORF Type: complete

Annotations of Ll_transcript_325230

• Blastp: 30S ribosomal protein S6 from Nitrosomonas with 30.56% of identity
• Blastx: 30S ribosomal protein S6 from Alcanivorax with 41.9% of identity
• Eggnog: Binds together with S18 to 16S ribosomal RNA (By similarity)(COG0360)
• Kegg: Link to kegg annotations (Neut_2382)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419062.1)
• Pfam: Ribosomal protein S6 (PF01250.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;