Protein coding transcript 203816

• Transcript: Ll_transcript_191275
• CDS coordinates: 3-332 (+)
• Peptide sequence: NIDHFHYQIQSKNISTIVMYQQTSDHAYPPHNQPTATGYPVSYSGNHPSIPPTSAPPPQFKAISDWSTGLFGCFSDCHSCCLTLWCPCVTFGRIAEIVDKGSTCKKLVL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_191275

• Blastp: Cell number regulator 11 from Zea with 49.33% of identity
• Blastx: Cell number regulator 10 from Zea with 59.46% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000550)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446232.1)
• Pfam: PLAC8 family (PF04749.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;