Protein coding transcript 203832

• Transcript: Ll_transcript_191308
• CDS coordinates: 75-785 (+)
• Peptide sequence: MAEQEQNPNTLHDSDAQTKQKKKLRKRKRVRKTEHVNPDFEEQEEKESEEEANEANVNDDKNDENSEENDNTNDEDDEGGENFASGIMSDESFLSLGLSEPTYTAIIDMGFDRMTQIQARAIPPLLTGDDVLGAARTGAGKTLAFLIPAVELLYKIQFTPRSGTGVVVICPTRELCIQTHAVAKELLKYHSLTLGLVIGGSARKGEAERIVKGVNLLVIGGSARKGEAERIVKGVNL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_191308

• Blastp: DEAD-box ATP-dependent RNA helicase 27 from Arabidopsis with 71.64% of identity
• Blastx: DEAD-box ATP-dependent RNA helicase 27 from Arabidopsis with 71.64% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (AT5G65900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003552054.1)
• Pfam: DEAD/DEAH box helicase (PF00270.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;