Protein coding transcript 20384

• Transcript: Ll_transcript_282783
• CDS coordinates: 2-406 (+)
• Peptide sequence: VNPSLFPCFTIVYIYPILYLIPGLHNLSLSLLHTLFLAMRKPCCHKEITNKGAWSKQEDQKLIDYIQVHGEGCWSSIPKAAGLYRCGKSCRLRWLNYLRPDIKRGVFGQDEEDLIIKLHALLGNRYLKSDEHTP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_282783

• Blastp: Transcription repressor MYB6 from Arabidopsis with 71.26% of identity
• Blastx: Transcription repressor MYB6 from Arabidopsis with 71.26% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT4G09460)
• CantataDB: Link to cantataDB annotations (CNT0000269)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432847.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;