Protein coding transcript 203864

• Transcript: Ll_transcript_192753
• CDS coordinates: 279-752 (+)
• Peptide sequence: MNSAFEYILKSGGVMREEDYPYSGTDRGTCKFDKKKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVFMQTYIGGVSCPYICSKHLDHGVLLVGYGSDAYAPIRMKEKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTSTT*
• ORF Type: complete

Annotations of Ll_transcript_192753

• Blastp: Cysteine protease RD19A from Arabidopsis with 78.85% of identity
• Blastx: Probable cysteine protease RD19B from Arabidopsis with 69.79% of identity
• Eggnog: cathepsin(COG4870)
• Kegg: Link to kegg annotations (AT4G39090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454205.1)
• Pfam: Papain family cysteine protease (PF00112.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;