Protein coding transcript 203893

• Transcript: Ll_transcript_193672
• CDS coordinates: 237-542 (+)
• Peptide sequence: MVQNRDKAWKKQKRAKNNYGKSDLERCLVEDTLVDKDDFDILAWWKTNSSKYRILSIMASDVFAILVSTVASKSCFSTSGHVLDVLCGSLSSKLVETLICT*
• ORF Type: complete

Annotations of Ll_transcript_193672

• Blastp: Putative AC transposase from Zea with 38.46% of identity
• Blastx: Putative AC transposase from Zea with 37.96% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016199860.1)
• Pfam: hAT family C-terminal dimerisation region (PF05699.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;