Transcript | Ll_transcript_325231 |
---|---|
CDS coordinates | 644-964 (+) |
Peptide sequence | MLMNFELEAKSINDFKTLLDKDERVIRHLVIKRDEAITEDCLPPPLFSGSADDSDDEDYEDWDDEDEMDDYDDEEEDGIIVIDGDDDDTDSRDDTSAYVKQPERTK* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | 30S ribosomal protein S6 from Alcanivorax with 40.74% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419062.1) |
Pfam | Ribosomal protein S6 (PF01250.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer