Protein coding transcript 203924

• Transcript: Ll_transcript_192814
• CDS coordinates: 1148-1750 (+)
• Peptide sequence: MFCPFQLSQDGIETQFATNHLGHFHLTNLLLNKMKQTAKATGIEGRIVNLSSIAHTYTYEEGIRFDAINDQFGYSDKKAYGQSKLANILHANELSRRLKEEGVNITANSVHPGVIMTPLMRHSSLLMNFLKMFTFYIWKNVPQGAATTCYVALHPSLKGVTGKYFLDCNEFEASSFAKDKILASKLWDFSNNFIKSLSKA*
• ORF Type: complete

Annotations of Ll_transcript_192814

• Blastp: Short-chain dehydrogenase TIC 32, chloroplastic from Pisum with 60.51% of identity
• Blastx: Short-chain dehydrogenase TIC 32, chloroplastic from Pisum with 60.8% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426534.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;