Protein coding transcript 204004

• Transcript: Ll_transcript_193703
• CDS coordinates: 169-804 (+)
• Peptide sequence: MMATKLAFTFTHPRPFISHTSLSSSSSSSSRGPHLLHLNRRHLCLRRRQFMPSLKATSDQQGKVEEDAVVDSNVLQYCSIDKKEKKTVGELEQEFLQALQAFYYEGKAIMSNEEFDNLKEELMWEGSSVVMLSSDEQKFLEASMAYVSGTPIMNDKEFDDLKLRLKAEGSEIVAEGPRCSLRSRKVYSDLSVDYLKMFLLNVPATVVALGL*
• ORF Type: complete

Annotations of Ll_transcript_193703

• Blastp: PGR5-like protein 1A, chloroplastic from Arabidopsis with 66.67% of identity
• Blastx: PGR5-like protein 1A, chloroplastic from Arabidopsis with 79.01% of identity
• Eggnog: PGR5-like protein 1A(ENOG4110C1Q)
• Kegg: Link to kegg annotations (AT4G22890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445088.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;