Protein coding transcript 204006

• Transcript: Ll_transcript_193707
• CDS coordinates: 811-1185 (+)
• Peptide sequence: MFLLNVPATVVALGLFFFLDDVTGFEITYILELPEPFSFIFTWFAAVPLIVWLAQSLTSAILKDFLILKGPCPNCGTENTSFFGTILSISSGSSTNNVKCENCGTALVYDSSTRLITLPEGSNA*
• ORF Type: complete

Annotations of Ll_transcript_193707

• Blastp: PGR5-like protein 1A, chloroplastic from Arabidopsis with 84.68% of identity
• Blastx: PGR5-like protein 1A, chloroplastic from Arabidopsis with 83.66% of identity
• Eggnog: PGR5-like protein 1A(ENOG4110C1Q)
• Kegg: Link to kegg annotations (AT4G22890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445088.1)
• Pfam: Topoisomerase DNA binding C4 zinc finger (PF01396.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;