Transcript | Ll_transcript_193736 |
---|---|
CDS coordinates | 176-1255 (+) |
Peptide sequence | MRRRRETASAEASKESSSGEAIDKSSDGGAKVYTNVHIANPRRSSFVWLALFLIITYCCTAIYNYQFQSMPVPLTADQAGKRGFSEIEAFKHVKALTEVGPHPVSSDALNLALQYVLEACQTINKTAHWEVDVEVDLFHAKSGANRLASGLFMGRTLVYSDLSHVVVRILPKYLSDAKEHSILVSSHIDTVFSTEGAGDCSSCVGVMLELARGVSQWAHGLKRGVIFLFNTGEEEGLDGAHSFITQHPWSNTVRMAIDLEAMGIGGKSSIFQAGPHPWAIEKFALVAKYPSGQIISQDLFSSGAIKSATDFQVYKEVAGLSGLDFAYVDNTAVYHTKNDKLELLKKGSLQHLGENMLAFL |
ORF Type | 3prime_partial |
Blastp | Endoplasmic reticulum metallopeptidase 1 from Homo with 35.44% of identity |
---|---|
Blastx | Endoplasmic reticulum metallopeptidase 1 from Homo with 35.44% of identity |
Eggnog | peptidase m28(COG2234) |
Kegg | Link to kegg annotations (79956) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452698.1) |
Pfam | Peptidase family M28 (PF04389.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer