Protein coding transcript 204033

• Transcript: Ll_transcript_193789
• CDS coordinates: 466-813 (+)
• Peptide sequence: MEFCTSIWTHSFHLLIRNCIHQDIFFCYLHWTILLNKLTKNQCIQARQSLIVRGLFPMLADPRHPAGSTSATSETILKVALDHGKTLGIIKSHDRVVVCQKLGDASVVKIIELED*
• ORF Type: complete

Annotations of Ll_transcript_193789

• Blastp: Pyruvate kinase 1, cytosolic from Oryza sativa with 69.23% of identity
• Blastx: Pyruvate kinase 1, cytosolic from Oryza sativa with 69.23% of identity
• Eggnog: Pyruvate kinase(COG0469)
• Kegg: Link to kegg annotations (4349774)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415272.1)
• Pfam: Pyruvate kinase, alpha/beta domain (PF02887.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;