Protein coding transcript 2041

• Transcript: Ll_transcript_325250
• CDS coordinates: 102-1241 (+)
• Peptide sequence: MDEKVEWCELPLELWPKIGKYLDKHIDILRFRSVCESWRSSISPFHLNSPSFPLQIPHPINSSIDAYLNKATLYLVQPTHASSNFQSFSKGYLIKVKESKNHPLHLVNPISDRKLGNHLGASPMVLNLLENHVFEVCKSYNVHSKGGHYVAVNKVVLFPNSTWINVENSVACCVFKEGRLGLMKHGYEKWKLVDENNFYYDDVIVFKGQFYVTDKWGTISWVDICSLKLIQYSPPLCGFGDKKHLVESCGSVYVVDRYYESEPRIRRRNHVGDLNHCAAVMGFKVYKLDEDWGTWVDVKNLGDRVFILGNSCNFSVSAKDVIGYQGNCIYFTDMFDVRMYNLQDHSFITIPFDPCIENFVWPTLSLQRIRGNNQFHASV*
• ORF Type: complete

Annotations of Ll_transcript_325250

• Blastp: F-box protein SKIP23 from Arabidopsis with 30.62% of identity
• Blastx: F-box protein SKIP23 from Arabidopsis with 30.62% of identity
• Eggnog: F-box protein(ENOG410ZMUJ)
• Kegg: Link to kegg annotations (AT2G17030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422541.1)
• Pfam: Protein of unknown function (DUF295) (PF03478.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;