Transcript | Ll_transcript_192091 |
---|---|
CDS coordinates | 1-603 (+) |
Peptide sequence | VYTDHVAIKYLLKKPHSKHRLIRWVLLLHEFDLDIRDKSGKENQVADHLSRLINENVVLKEKEIAKTFPDEKLFQLQDRPWFADFANYKASGIIPEHFNYQQKNIFLKRVKDYIWDEPYLFKEGTDNIIRRCVDESEAHKILWHCHNSAYWGHFNGNRTAAKVLQSGFLWPTIYKDAHLHVQKCDACQKSGGLGKQNKMPL |
ORF Type | internal |
Blastp | Uncharacterized mitochondrial protein AtMg00750 from Arabidopsis with 60.53% of identity |
---|---|
Blastx | Uncharacterized mitochondrial protein AtMg00750 from Arabidopsis with 60.53% of identity |
Eggnog | Retrotransposon protein(COG2801) |
Kegg | Link to kegg annotations (ArthMp067) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416042.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer