Protein coding transcript 204211

• Transcript: Ll_transcript_193837
• CDS coordinates: 24-1130 (+)
• Peptide sequence: MKRQENKMEKAIQRQKVLLQHLQPISSTSSFSSQPTTHLSASTCAAGNFSEDDVVVVAAYRTPLCKAKRGGFKDTYPDDLLATVLKAVIDKTNLDPSEVGDIIVGTVLGPGSERAIECKMAAFYAGFPATVPLRTVNRQCSSGLQAVADVAAYIKSGAYDIGIGAGLEYMSQLNTLSFGKVNPKAKLFPQAGDCLLPMGVTSENVAARFGLTRLEQDQAAVESHRRAAAATAAGKFKDEIVPVHTRFVDPKTGEEKQIVVSVDDGIRPQTTLASLAKLKPVFKADGSTTAGNASQVTDGAAAVLLMKRRIALQKGLPILGTFRTFTAVGVDPDIMGVGPAVAIPAAVKSAGLQLSDIQLFEINEVTKF*
• ORF Type: complete

Annotations of Ll_transcript_193837

• Blastp: 3-ketoacyl-CoA thiolase 2, peroxisomal from Arabidopsis with 73.7% of identity
• Blastx: 3-ketoacyl-CoA thiolase 2, peroxisomal from Arabidopsis with 73.42% of identity
• Eggnog: acetyl-coa acetyltransferase(COG0183)
• Kegg: Link to kegg annotations (AT2G33150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463412.1)
• Pfam: Thiolase, N-terminal domain (PF00108.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;