Transcript | Ll_transcript_193634 |
---|---|
CDS coordinates | 1826-2638 (+) |
Peptide sequence | MVNLDALYVRLFISSPNICSDIIIQGLTIFAPVDSPNTDGIDPDSCNNTRIEDCYIVSGDDCVAIKSGWDEYGIKFGMPSQHIIIRRLTCISPDSAMIALGSEMSGGIEDVRVENITALNTQSAVRIKTGAGRGGYVKDIFVKGMSLNKMKYVFWMTGSYGSHPDTGFDPKALPNITAINYRDVRADHCKYSARLEGIPNDPFTGICISNVTITGGKKKLQWNCTHVGGVTSNVLPKPCKLLPEKKRTFDCPFPEDKLPIENVQLKTCCF* |
ORF Type | complete |
Blastp | Probable polygalacturonase from Vitis with 63.71% of identity |
---|---|
Blastx | Probable polygalacturonase from Vitis with 61.98% of identity |
Eggnog | Glycoside hydrolase family 28(COG5434) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003533980.1) |
Pfam | Glycosyl hydrolases family 28 (PF00295.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer