Protein coding transcript 2043

• Transcript: Ll_transcript_325164
• CDS coordinates: 2-406 (+)
• Peptide sequence: TMSGDEVAIPPPVQWAQRTHVVFVTLCVEDCKNPDIQIEADKIVFKGIGGTEKKKYEVTIPLFKEIDPEKSVKFIRDRNIELVLKKKEEGPYWSYLLKDKKKYHWLKVDFNKWKDEDDSEDELNVGGGGGEDLEE
• ORF Type: internal

Annotations of Ll_transcript_325164

• Blastp: Uncharacterized protein CG16817 from Sophophora with 43.8% of identity
• Blastx: Uncharacterized protein CG16817 from Sophophora with 43.8% of identity
• Eggnog: Prostaglandin E synthase 3 (Cytosolic)(ENOG41121RT)
• Kegg: Link to kegg annotations (Dmel_CG16817)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001236771.2)
• Pfam: CS domain (PF04969.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;