Transcript | Ll_transcript_325164 |
---|---|
CDS coordinates | 2-406 (+) |
Peptide sequence | TMSGDEVAIPPPVQWAQRTHVVFVTLCVEDCKNPDIQIEADKIVFKGIGGTEKKKYEVTIPLFKEIDPEKSVKFIRDRNIELVLKKKEEGPYWSYLLKDKKKYHWLKVDFNKWKDEDDSEDELNVGGGGGEDLEE |
ORF Type | internal |
Blastp | Uncharacterized protein CG16817 from Sophophora with 43.8% of identity |
---|---|
Blastx | Uncharacterized protein CG16817 from Sophophora with 43.8% of identity |
Eggnog | Prostaglandin E synthase 3 (Cytosolic)(ENOG41121RT) |
Kegg | Link to kegg annotations (Dmel_CG16817) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001236771.2) |
Pfam | CS domain (PF04969.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer