Protein coding transcript 204392

• Transcript: Ll_transcript_192628
• CDS coordinates: 84-836 (+)
• Peptide sequence: MNTDNDSKKVENSSVQMDYIDSSVLQGKDREKEELTETMNKLHIEGSSSGSGPFKRKPVIIIVVGMAGSGKTTLLHRLVAHTHQKNIRGYVMNLDPAVMTLPYASNIDIRDTVKYKEVMKQFNLGPNGGIMTSLNLFATKFDEVVSVIEKRADQLDYVLVDTPGQIEIFTWSASGAIITEAFASTFPTVVTYVVDTPRAENPTTFMSNMLYACSILYKTRLPLILAFNKVDVAQHEFALEVLFIFDESYV*
• ORF Type: complete

Annotations of Ll_transcript_192628

• Blastp: GPN-loop GTPase 1 from Dictyostelium with 68.95% of identity
• Blastx: GPN-loop GTPase 1 from Dictyostelium with 68.95% of identity
• Eggnog: GPN-loop GTPase 1(ENOG410XNRC)
• Kegg: Link to kegg annotations (DDB_G0293220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463276.1)
• Pfam: CobW/HypB/UreG, nucleotide-binding domain (PF02492.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;