Transcript | Ll_transcript_325221 |
---|---|
CDS coordinates | 225-707 (+) |
Peptide sequence | MPVQQAEGMWPTLVASKKLNKRIGSRNFLADYSGYAEQPLLGITTDDQSSLNTESFLNDQKETQNYRVFVSTWNVGGIAPDEGLNIKDLLDTCNQSCDIYVLGFQEIVPLKASNVLGPENSKISMKWNKIIREALNKRTHQLFKEQVGPKKIEVKKNNCPK |
ORF Type | 3prime_partial |
Blastp | Type IV inositol polyphosphate 5-phosphatase 9 from Arabidopsis with 53.1% of identity |
---|---|
Blastx | Type IV inositol polyphosphate 5-phosphatase 9 from Arabidopsis with 53.1% of identity |
Eggnog | inositol(COG5411) |
Kegg | Link to kegg annotations (AT2G01900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459759.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer