Protein coding transcript 2044

• Transcript: Ll_transcript_325221
• CDS coordinates: 225-707 (+)
• Peptide sequence: MPVQQAEGMWPTLVASKKLNKRIGSRNFLADYSGYAEQPLLGITTDDQSSLNTESFLNDQKETQNYRVFVSTWNVGGIAPDEGLNIKDLLDTCNQSCDIYVLGFQEIVPLKASNVLGPENSKISMKWNKIIREALNKRTHQLFKEQVGPKKIEVKKNNCPK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_325221

• Blastp: Type IV inositol polyphosphate 5-phosphatase 9 from Arabidopsis with 53.1% of identity
• Blastx: Type IV inositol polyphosphate 5-phosphatase 9 from Arabidopsis with 53.1% of identity
• Eggnog: inositol(COG5411)
• Kegg: Link to kegg annotations (AT2G01900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459759.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;