Transcript | Ll_transcript_194046 |
---|---|
CDS coordinates | 487-1071 (+) |
Peptide sequence | MEEDEIQAHASKFPRIGNGRNDSSNKIGTRGGLGSGEQQHQIYEEVDGGGSTNRFHSWHHSSRIIRVSRASGGKDRHSKVMTSRGLRDRRVRLSVATAIQFYDLQDRLGFDQPSKAVEWLIKSASDAISELPSLNNTFPDTPKELSVGIEQGFDSAEAEIEGNTNYHNQQQHQHNNNQSQNLSLSKSACSSTSET |
ORF Type | 3prime_partial |
Blastp | Transcription factor TCP2 from Arabidopsis with 62.5% of identity |
---|---|
Blastx | Transcription factor TCP2 from Arabidopsis with 84.27% of identity |
Eggnog | Transcription factor(ENOG410YEYG) |
Kegg | Link to kegg annotations (AT4G18390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464085.1) |
Pfam | TCP family transcription factor (PF03634.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer