Protein coding transcript 204431

• Transcript: Ll_transcript_194014
• CDS coordinates: 436-1020 (+)
• Peptide sequence: MEEDEIQAHASKFPRIGNGRNDSSNKIGTRGGLGSGEQQHQIYEEVDGGGSTNRFHSWHHSSRIIRVSRASGGKDRHSKVMTSRGLRDRRVRLSVATAIQFYDLQDRLGFDQPSKAVEWLIKSASDAISELPSLNNTFPDTPKELSVGIEQGFDSAEAEIEGNTNYHNQQQHQHNNNQSQNLSLSKSACSSTSET
• ORF Type: 3prime_partial

Annotations of Ll_transcript_194014

• Blastp: Transcription factor TCP2 from Arabidopsis with 62.5% of identity
• Blastx: Transcription factor TCP2 from Arabidopsis with 84.27% of identity
• Eggnog: Transcription factor(ENOG410YEYG)
• Kegg: Link to kegg annotations (AT4G18390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464085.1)
• Pfam: TCP family transcription factor (PF03634.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;