Protein coding transcript 204445

• Transcript: Ll_transcript_194022
• CDS coordinates: 1-936 (+)
• Peptide sequence: LQDRLGYEQPSKAVEWLINAASDAISELPSLNTNFLDTPDELNVEKRAFFDEVGGDTNNYNQNQNQNLSLSKSACSCSSTSETSKGSTLSLSRSEICVKARERARERAAKDKEKENESFHIVTNHHNVTQTGSFTELLTGGIGNVATKTSAIVGYESNIFNNKAKQWSPMVMDYFNSGLSSRNVSPFSGENHSDQLQHFSFIPDHNFIPCSQSSGSDYNLNFTISPSLFGYNRGTLQSNSQSHIIDGSTNNLPLFIGGATLSTSADSTMDTSINHHQQQQLQFSTVFGGSLQLCYGDGTRNSDQKGKAKNC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_194022

• Blastp: Transcription factor TCP2 from Arabidopsis with 38.19% of identity
• Blastx: Transcription factor TCP2 from Arabidopsis with 75.61% of identity
• Eggnog: Transcription factor(ENOG410YEYG)
• Kegg: Link to kegg annotations (AT4G18390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418315.1)
• Pfam: TCP family transcription factor (PF03634.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;