Protein coding transcript 204448

• Transcript: Ll_transcript_194032
• CDS coordinates: 202-519 (+)
• Peptide sequence: MEEDDENQAHACKFPRIGSTRNESNNCSRIVRVSRACGGKDRHSKVMTSKGLRDRRVRLSVTTAIEFYDLQDRLGYEQPSKAVEWLINAASDAISELPSLNTTFPD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_194032

• Blastp: Transcription factor TCP24 from Arabidopsis with 65.49% of identity
• Blastx: Transcription factor TCP24 from Arabidopsis with 65.49% of identity
• Eggnog: TCP family transcription factor(ENOG41107RM)
• Kegg: Link to kegg annotations (AT1G30210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418315.1)
• Pfam: TCP family transcription factor (PF03634.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;