Protein coding transcript 20456

• Transcript: Ll_transcript_282925
• CDS coordinates: 253-879 (+)
• Peptide sequence: MVHGKHIFQYANLNSSFNQLFNIAMISGTTLTMNKIVESYKGFEHINKLIDVGGGLGIALNIITSKYPHIQGVNFDLPQVIERASPYPGVEHVGGNMFEYVPHGDAIFMKCVLHDWNDEDCLKVLKNCYAAIPENGKVIVVEGILPFEPETTDAVKSISKFDVLMMTLNPGGKERSEYEFMTLAKGAGFSGITYKCFVCDFWVMEFYK*
• ORF Type: complete

Annotations of Ll_transcript_282925

• Blastp: Anthranilate N-methyltransferase from Ruta with 57% of identity
• Blastx: Anthranilate N-methyltransferase from Ruta with 57.01% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459523.1)
• Pfam: O-methyltransferase (PF00891.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;