Transcript | Ll_transcript_192877 |
---|---|
CDS coordinates | 182-547 (+) |
Peptide sequence | MGVEEGVPAALGFHMPAEWERHSHCWMGWPERCDNWRDNAIHAQRLFTTVASAISAFEPVTICASSSQWENARNQLPLHIRVVEISMNDSWFRDTGPTVSFSLFFSFNSFLILSNNTCFSS* |
ORF Type | complete |
Blastp | Agmatine deiminase from Arabidopsis with 70.33% of identity |
---|---|
Blastx | Agmatine deiminase from Arabidopsis with 69.83% of identity |
Eggnog | Agmatine deiminase(COG2957) |
Kegg | Link to kegg annotations (AT5G08170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439055.1) |
Pfam | Porphyromonas-type peptidyl-arginine deiminase (PF04371.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer