Transcript | Ll_transcript_282926 |
---|---|
CDS coordinates | 60-929 (+) |
Peptide sequence | MEKVEQTNDALSNIDLKDKQLNHKNTILEEKSFTYALQLVNSSVLSMALKSAIELGVFDIINKAGVGAKLSAKDIAEEFSCKNPDATTMLDRILRLLANHSIVDCVVVDDKNGPPPHLQRLYSMAPVTTYFVSNGGGGSLAPLMVFTHDKITFESWYQLKDAILEGGIPFNRVHGKHVFQYANLDSNFNQLFNIAMINRATLLMNKILESYKGFEHINKLIDVGGGLGIALNIITSKYPHIKGINFDLPQVIERASPYPGVEHVGGNMFKNVPQGDAILIKCVLHDWSDE |
ORF Type | 3prime_partial |
Blastp | Caffeic acid 3-O-methyltransferase 1 from Populus with 53.61% of identity |
---|---|
Blastx | Caffeic acid 3-O-methyltransferase 1 from Populus with 53.61% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459523.1) |
Pfam | Dimerisation domain (PF08100.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer