Protein coding transcript 204570

• Transcript: Ll_transcript_192929
• CDS coordinates: 318-698 (+)
• Peptide sequence: MCCFVRPGVVLLSWTDDETDPQYERSVEAYSLLSSVTDANNRKLEIIKLHVPGPLYMTEEEAAGVFQDDEAKPRLPGTRLAASYVNFYIANGAIITPQFGDKKWDDEAVRVLSKAFPDHKVSKTDC*
• ORF Type: complete

Annotations of Ll_transcript_192929

• Blastp: Agmatine deiminase from Arabidopsis with 73.55% of identity
• Blastx: Agmatine deiminase from Arabidopsis with 75.71% of identity
• Eggnog: Agmatine deiminase(COG2957)
• Kegg: Link to kegg annotations (AT5G08170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439055.1)
• Pfam: Porphyromonas-type peptidyl-arginine deiminase (PF04371.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;