Transcript | Ll_transcript_325203 |
---|---|
CDS coordinates | 31-537 (+) |
Peptide sequence | MFDALDKLFALHNAMLLESRMMKAFFIYSILIFVIHMLTSTKQTYNVRPWLYIGLCATLFIEVSIIRFTNDKIEQQTWIINKVRLFYMVAAAVQLLYAICMYRDYEVLNHRMLLTLMDRVNNMQMQKELLDVDSDDENWSQWIDADLSDDVNCLDDPSYLLPEEVEEKS |
ORF Type | 3prime_partial |
Blastp | Protein GAMETE EXPRESSED 1 from Arabidopsis with 60.65% of identity |
---|---|
Blastx | Protein GAMETE EXPRESSED 1 from Arabidopsis with 60.65% of identity |
Eggnog | NA(ENOG41121QC) |
Kegg | Link to kegg annotations (AT5G55490) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444829.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer