Protein coding transcript 2046

• Transcript: Ll_transcript_325203
• CDS coordinates: 31-537 (+)
• Peptide sequence: MFDALDKLFALHNAMLLESRMMKAFFIYSILIFVIHMLTSTKQTYNVRPWLYIGLCATLFIEVSIIRFTNDKIEQQTWIINKVRLFYMVAAAVQLLYAICMYRDYEVLNHRMLLTLMDRVNNMQMQKELLDVDSDDENWSQWIDADLSDDVNCLDDPSYLLPEEVEEKS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_325203

• Blastp: Protein GAMETE EXPRESSED 1 from Arabidopsis with 60.65% of identity
• Blastx: Protein GAMETE EXPRESSED 1 from Arabidopsis with 60.65% of identity
• Eggnog: NA(ENOG41121QC)
• Kegg: Link to kegg annotations (AT5G55490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444829.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;