Protein coding transcript 204622

• Transcript: Ll_transcript_267722
• CDS coordinates: 458-781 (+)
• Peptide sequence: MDSVAVQEFSRTLFNMRPDIALSMAQTIFQFDMRQILNFVTVPCHIIQSTKDLAVPLVVAEYLQQNVGGKSIVEVMPTEGHLPQLSSPDIVIPVLINHIRNDIAEPK*
• ORF Type: complete

Annotations of Ll_transcript_267722

• Blastp: Probable esterase KAI2 from Arabidopsis with 78.85% of identity
• Blastx: Probable esterase D14L from Oryza sativa with 78.91% of identity
• Eggnog: Alpha beta hydrolase(COG0596)
• Kegg: Link to kegg annotations (AT4G37470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431008.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;