Protein coding transcript 204688

• Transcript: Ll_transcript_266849
• CDS coordinates: 1-537 (+)
• Peptide sequence: QQQMLMWKSTPKNVLLLKKLGDQLMEEAKEVASFLYYQEKMNVFVEPDVHDIFARIPGFGFVQTFYIQDTCDLHEKVDFVACLGGDGVILHASNLFRAAVPPVVSFNLGSLGFLTSHNFEDYRQHLQQVIHGSKTRDGVYITLRMRLRCEIFRKGKAAPGKVFDILNEVVVDRGSNPYL
• ORF Type: internal

Annotations of Ll_transcript_266849

• Blastp: NAD kinase 2, chloroplastic from Arabidopsis with 84.92% of identity
• Blastx: NAD kinase 2, chloroplastic from Arabidopsis with 84.92% of identity
• Eggnog: Catalyzes the phosphorylation of NAD to NADP. Utilizes ATP and other nucleoside triphosphates as well as inorganic polyphosphate as a source of phosphorus (By similarity)(COG0061)
• Kegg: Link to kegg annotations (AT1G21640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003523423.1)
• Pfam: ATP-NAD kinase (PF01513.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;