| Transcript | Ll_transcript_267414 |
|---|---|
| CDS coordinates | 343-684 (+) |
| Peptide sequence | MLVIGANSHVLCSSIYQNHNHKCLLVSGFGFLFSLKSRCLNTWIIDHRNKEGKNRRRNLKVEASWWGQEVPKPSVIEMEAINDSEHFDQILQHAQQNSQPIIIDWYSFFRISI* |
| ORF Type | complete |
| Blastp | Thioredoxin-like 3-1, chloroplastic from Arabidopsis with 50% of identity |
|---|---|
| Blastx | - |
| Eggnog | Thioredoxin(COG0526) |
| Kegg | Link to kegg annotations (AT5G06690) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019440811.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer