Protein coding transcript 204754

• Transcript: Ll_transcript_267416
• CDS coordinates: 343-915 (+)
• Peptide sequence: MLVIGANSHVLCSSIYQNHNHKCLLVSGFGFLFSLKSRCLNTWIIDHRNKEGKNRRRNLKVEASWWGQEVPKPSVIEMEAINDSEHFDQILQHAQQNSQPIIIDWMAVWCRKCIYLKPKLEKLAAEFDTKVKFYYVDVNKVPQTLVKRGNISKMPTIQIWKDGEMKGEVIGGHKGWLVIEEVREMIQKFV*
• ORF Type: complete

Annotations of Ll_transcript_267416

• Blastp: Thioredoxin-like 3-1, chloroplastic from Arabidopsis with 71.76% of identity
• Blastx: Thioredoxin-like 3-1, chloroplastic from Arabidopsis with 71.32% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (AT5G06690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440811.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;