Protein coding transcript 204755

• Transcript: Ll_transcript_267417
• CDS coordinates: 343-735 (+)
• Peptide sequence: MLVIGANSHVLCSSIYQNHNHKCLLVSGFGFLFSLKSRCLNTWIIDHRNKEGKNRRRNLKVEASWWGQEVPKPSVIEMEAINDSEHFDQILQHAQQNSQPIIIDWMAVWCRKCIYLKPKLEKLAAEFDTK*
• ORF Type: complete

Annotations of Ll_transcript_267417

• Blastp: Thioredoxin-like 3-1, chloroplastic from Arabidopsis with 63.93% of identity
• Blastx: Thioredoxin-like 3-1, chloroplastic from Arabidopsis with 57.75% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (AT5G06690)
• CantataDB: -
• Mirbase: mtr-MIR2614 (MI0011875)
• Ncbi protein: Link to NCBI protein (XP_019440811.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;