Protein coding transcript 204790

• Transcript: Ll_transcript_268039
• CDS coordinates: 750-1079 (+)
• Peptide sequence: MFGVSSPLALIMGIGMCLLPDSPRWLLLCAIQGKGDSKNLKDRAIHCLCQLRGQAIADSAPQQVDEILAELSYVGEEKVTFGELFRGKCKKALVIGGGLVLFQQVLQVK*
• ORF Type: complete

Annotations of Ll_transcript_268039

• Blastp: D-xylose-proton symporter-like 2 from Arabidopsis with 67.92% of identity
• Blastx: D-xylose-proton symporter-like 2 from Arabidopsis with 58.43% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT5G17010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454337.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;