Transcript | Ll_transcript_268030 |
---|---|
CDS coordinates | 1-792 (+) |
Peptide sequence | QSSTLSGITWYNLSSVEIGLVTSGSLYGALIGSLLAFNIADFIGRKRELIAAALVYLVGALVTAVAPNFPVLVVGRLVFGLGIGLAMHAAPMYIAETAPTSIRGLLISLKEFFIVLGMVAGYGIGSLLVDTVSGWRYMFGVSSPLALIMGIGMCLLPDSPRWLLLCAIQGKGDSKNLKDRAIHCLCQLRGQAIADSAPQQVDEILAELSYVGEEKVTFGELFRGKCKKALVIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAA |
ORF Type | internal |
Blastp | D-xylose-proton symporter-like 2 from Arabidopsis with 73.58% of identity |
---|---|
Blastx | D-xylose-proton symporter-like 2 from Arabidopsis with 73.58% of identity |
Eggnog | Transporter(ENOG410XNQK) |
Kegg | Link to kegg annotations (AT5G17010) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454336.1) |
Pfam | Major Facilitator Superfamily (PF07690.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer