Protein coding transcript 204799

• Transcript: Ll_transcript_268034
• CDS coordinates: 788-1231 (+)
• Peptide sequence: MFGVSSPLALIMGIGMCLLPDSPRWLLLCAIQGKGDSKNLKDRAIHCLCQLRGQAIADSAPQQVDEILAELSYVGEEKVTFGELFRGKCKKALVIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAASDATRVSILLGLFKLIMTGAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_268034

• Blastp: D-xylose-proton symporter-like 2 from Arabidopsis with 74.5% of identity
• Blastx: D-xylose-proton symporter-like 2 from Arabidopsis with 65.81% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT5G17010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454337.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;